language:
Find link is a tool written by Edward Betts.searching for sequence homology 364 found (554 total)
alternate case: Sequence homology
Cystatin
(1,073 words)
[view diff]
exact match in snippet
view article
find links to article
cystatins are a family of cysteine protease inhibitors which share a sequence homology and a common tertiary structure of an alpha helix lying on top ofP73 (1,132 words) [view diff] exact match in snippet view article find links to article
in normal cells. The p73 gene encodes a protein with a significant sequence homology and a functional similarity with the tumor suppressor p53. The over-expressionMMP27 (1,341 words) [view diff] exact match in snippet view article find links to article
MMP (CMMP), MMP-27 actually shows very little sequence homology with this protease. Sequence homology predicts that the human MMP-27 gene encodes theARID domain (609 words) [view diff] exact match in snippet view article find links to article
additional helix at either or both ends of the basic six. Based on primary sequence homology, they can be partitioned into three structural classes: Minimal ARID5-HT1 receptor (472 words) [view diff] exact match in snippet view article find links to article
G protein-coupled receptors (GPCRs) that share 40% to 63% overall sequence homology, including 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. Receptors ofEstrogen-related receptor alpha (1,973 words) [view diff] exact match in snippet view article find links to article
(Estrogen Related Receptor Alpha) gene. ERRα was originally cloned by DNA sequence homology to the estrogen receptor alpha (ERα, NR3A1), but subsequent ligandGRID2 (2,151 words) [view diff] exact match in snippet view article find links to article
receptor subtype of ionotropic glutamate receptors. They possess 14–24% sequence homology with AMPA, kainate, and NMDA subunits, but, despite their name, doLipocalin (1,986 words) [view diff] exact match in snippet view article find links to article
siderophores or flavonoids) as well as heme. They share limited regions of sequence homology and a common tertiary structure architecture. This is an eight strandedFGF18 (2,153 words) [view diff] exact match in snippet view article find links to article
and Fgf18 were described and confirmed as being closely related by sequence homology to Fgf8. The three proteins were eventually grouped into the FGF8Bamfordvirae (261 words) [view diff] exact match in snippet view article find links to article
selfish genetic elements, represented by labeled circles. Links between circles are color-coded by the gene whose sequence homology establishes the link.PCDH12 (525 words) [view diff] exact match in snippet view article find links to article
cluster transcripts, notably the first large exon, but no significant sequence homology exists. The function of this cellular adhesion protein is undeterminedBRD4 (2,098 words) [view diff] exact match in snippet view article find links to article
residues. BRD4 also has an extended C-terminal domain with little sequence homology to other BET family members. The two bromodomains in BRD4, termedStemodene (161 words) [view diff] exact match in snippet view article find links to article
undiscovered in the "completed" genome. Stemarene synthase demonstrates high sequence homology with stemodene synthase, thus accounting for the latter's discoveryFOLR2 (785 words) [view diff] exact match in snippet view article find links to article
5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. The FOLR2 proteinHalcurin (581 words) [view diff] exact match in snippet view article find links to article
polypeptide neurotoxin from the sea anemone Halcurias sp. Based on sequence homology to type 1 and type 2 sea anemone toxins it is thought to delay channelLSM6 (523 words) [view diff] exact match in snippet view article find links to article
Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteinsPeptide PHI (632 words) [view diff] exact match in snippet view article find links to article
adenylate cyclase-activating polypeptide (PACAP) and it has an amino acid sequence homology to vasoactive intestinal peptide, secretin, glucagon, and other growthFHOD1 (979 words) [view diff] exact match in snippet view article find links to article
but is found in abundance in the spleen. The encoded protein has sequence homology to diaphanous and formin proteins within the Formin Homology (FH)1HPgV-2 (579 words) [view diff] exact match in snippet view article find links to article
an X protein of unknown function. Different strains of HPgV-2 have sequence homology of 90% or more. Wang, Haiying; Wan, Zhengwei; Xu, Ru; Guan, Yujuan;USP53 (780 words) [view diff] exact match in snippet view article find links to article
Although USP53 is classified as a deubiquitinating enzyme based on sequence homology to other proteases from this group, it lacks a functionally essentialMRPL55 (559 words) [view diff] exact match in snippet view article find links to article
sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Multiple transcript variantsMRPS18A (555 words) [view diff] exact match in snippet view article find links to article
sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomalPhosducin-like (924 words) [view diff] exact match in snippet view article find links to article
heterotrimeric G proteins. The protein shares extensive amino acid sequence homology with phosducin, a phosphoprotein expressed in the retina and pinealSerine dehydratase (1,523 words) [view diff] exact match in snippet view article find links to article
threonine dehydratase and human serine dehydratase. Human SDH shows sequence homology of 27% with the yeast enzyme and 27% with the E. coli enzyme. OverallMRPS9 (223 words) [view diff] exact match in snippet view article find links to article
sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. [provided by RefSeq, JulMRPS2 (241 words) [view diff] exact match in snippet view article find links to article
sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomalSALL4 (4,631 words) [view diff] exact match in snippet view article find links to article
gene family, SALL4. The SALL genes were identified based on their sequence homology to Spalt, which is a homeotic gene originally cloned in DrosophilaC1orf94 (1,275 words) [view diff] no match in snippet view article find links to article
Chromosome 1 Opening Reading Frame 94 or C1orf94 is a protein in human coded by the C1orf94 gene. The function of this protein is still poorly understoodHormone-sensitive lipase (1,904 words) [view diff] exact match in snippet view article find links to article
structure of human hormone-sensitive lipase: possible significance of a sequence homology with a lipase of Moraxella TA144, an antarctic bacterium". ProceedingsDNA-deoxyinosine glycosylase (1,301 words) [view diff] exact match in snippet view article find links to article
DNA Uracil Glycosylase superfamily, each classified based on their sequence homology, and biochemical and structural similarities. Uracil and hypoxanthineKynurenine 3-monooxygenase (1,970 words) [view diff] exact match in snippet view article find links to article
models and in yeast, both of which have been demonstrated to have high sequence homology with the human kynurenine 3-monooxygenase protein. Studies have shownProtein chemical shift prediction (1,421 words) [view diff] exact match in snippet view article find links to article
using a combination of the two approaches. Predicting shifts via sequence homology: these are based on the simple observation that similar protein sequencesMRPS5 (449 words) [view diff] exact match in snippet view article find links to article
sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomalInterleukin 17 (3,989 words) [view diff] exact match in snippet view article find links to article
significant sequence homology with other cytokines. Among IL-17 family members, the IL-17F isoforms 1 and 2 (ML-1) have the highest sequence homology with IL-17AAblomin (447 words) [view diff] exact match in snippet view article find links to article
cystein-rich domain. It has a molecular mass of 25 kDa. Ablomin shows great sequence homology with triflin (83.7%) and latisemin (61.5%), two other snake venomVoltage-gated potassium channel (1,770 words) [view diff] exact match in snippet view article find links to article
state. Alpha subunits form the actual conductance pore. Based on sequence homology of the hydrophobic transmembrane cores, the alpha subunits of voltage-gatedRNASE1 (1,005 words) [view diff] exact match in snippet view article find links to article
maturation inhibitory protein from urine of pregnant women: N-terminal sequence homology with human nonsecretory ribonuclease". Chemical & Pharmaceutical BulletinElafin (1,033 words) [view diff] exact match in snippet view article find links to article
elastase-specific inhibitor (ESI) from bronchial secretions. Evidence of sequence homology and immunological cross-reactivity". Biol. Chem. Hoppe-Seyler. 373CIP/KIP (2,181 words) [view diff] exact match in snippet view article find links to article
three proteins: p21cip1/waf1, P27kip1, p57kip2 These proteins share sequence homology at the N-terminal domain which allows them to bind to both the cyclinAMN082 (248 words) [view diff] exact match in snippet view article find links to article
(Group I, Group II, Group III) based on pharmacological profile, sequence homology, and preferred signal transduction pathway. mGlur7 is a member ofBmKAEP (751 words) [view diff] exact match in snippet view article find links to article
feature: it interacts with mammalian Na+ channels. Because of its sequence homology with other β-toxins, BmKAEP is predicted to bind to site 4 (S4) ofFibroblast growth factor (3,123 words) [view diff] exact match in snippet view article find links to article
compared to the FGFs. Although these factors possess remarkably similar sequence homology, they do not bind FGFRs and are involved in intracellular processesMIF4GD (2,536 words) [view diff] no match in snippet view article find links to article
MIF4GD, or MIF4G domain-containing protein, is a protein which in humans is encoded by the MIF4GD gene. It is also known as SLIP1, SLBP (Stem-Loop BindingHDAC9 (2,396 words) [view diff] exact match in snippet view article find links to article
transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologousPTPN9 (680 words) [view diff] exact match in snippet view article find links to article
expression of a cytosolic megakaryocyte protein-tyrosine-phosphatase with sequence homology to retinaldehyde-binding protein and yeast SEC14p". Proc Natl AcadDomain of unknown function (881 words) [view diff] exact match in snippet view article find links to article
third possessed a novel protein fold. Some DUF families share remote sequence homology with domains that has characterized function. Computational work canCangitoxin (798 words) [view diff] exact match in snippet view article find links to article
Sea anemone toxins act at the receptor site 3. On the basis of its sequence homology, cangitoxin most likely acts on the same receptor site of the previouslyFDC-SP (1,089 words) [view diff] exact match in snippet view article find links to article
within the human, rat, mouse and chimpanzee genome. There is a 70% sequence homology between mouse and rat and a 45% homology between human and mouse.Fibroblast growth factor (3,123 words) [view diff] exact match in snippet view article find links to article
compared to the FGFs. Although these factors possess remarkably similar sequence homology, they do not bind FGFRs and are involved in intracellular processesAltitoxin (219 words) [view diff] exact match in snippet view article find links to article
including bestoxin, birtoxin, ikitoxin and dortoxin. Altitoxin has sequence homology to scorpion β-toxins, suggesting it might target sodium channels.Cdc25 (1,035 words) [view diff] exact match in snippet view article find links to article
target them. A new class of peptide-derived inhibitors, based on sequence homology with the protein substrate, can be developed. It is challenging toAPETx1 (764 words) [view diff] exact match in snippet view article find links to article
elegantissima toxin that targets hERG channels. Moreover, APETx1 has 54% sequence homology with BDS1, which is also produced by sea anemones and targets voltage-gatedPTPN21 (772 words) [view diff] exact match in snippet view article find links to article
isolation of PTP-RL10, a novel cytoplasmic-type phosphatase with sequence homology to cytoskeletal protein 4.1". Oncogene. 10 (2): 407–14. PMID 7838537Histone acetyltransferase (6,148 words) [view diff] exact match in snippet view article find links to article
class. HATs can be grouped into several different families based on sequence homology as well as shared structural features and functional roles. The Gcn5-relatedPentadin (1,755 words) [view diff] exact match in snippet view article find links to article
sweet tasting proteins have different molecular lengths, with no sequence homology and little to none structural homology. Efforts to identify structuralDnaQ (1,154 words) [view diff] exact match in snippet view article find links to article
exonuclease in humans, was initially called DNase III because it showed sequence homology with dnaQ in E. coli and with eukaryotic DNA polymerase epsilon andPhosphatase (1,483 words) [view diff] exact match in snippet view article find links to article
families. Phosphatases are classified by substrate specificity and sequence homology in catalytic domains. Despite their classification into over one hundredPOU domain (999 words) [view diff] exact match in snippet view article find links to article
domain is always accompanied by a homeodomain. Despite the lack of sequence homology, 3D structure of POUs is similar to 3D structure of bacteriophageCHRNA2 (865 words) [view diff] exact match in snippet view article find links to article
alpha 2 receptor locus, (CHRNA2), within an 8p21 mapped locus, by sequence homology with rat DNA". Somat. Cell Mol. Genet. 21 (2): 147–50. doi:10.1007/BF02255790Collagen, type XIX, alpha 1 (743 words) [view diff] exact match in snippet view article find links to article
consists of multiple collagenous subdomains and exhibits limited sequence homology to alpha 1(XVI)". J. Biol. Chem. 269 (28): 18549–57. doi:10BBS10 (796 words) [view diff] exact match in snippet view article find links to article
is a human gene. The Bardet-Biedl syndrome 10 protein has distant sequence homology to type II chaperonins. As a molecular chaperone, this protein mayCLCN4 (863 words) [view diff] exact match in snippet view article find links to article
quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 4 has an evolutionary conserved CpG island and isLactobacillus acidophilus (3,290 words) [view diff] exact match in snippet view article find links to article
along with low sequence homology (31-72%). However, the C-terminus shows low amino acid variability and high amino acid sequence homology (77-99%).L. acidophilusTransient receptor potential calcium channel family (1,621 words) [view diff] exact match in snippet view article find links to article
TRPV, TRPM, TRPN, TRPA, TRPP, and TRPML) based on their amino acid sequence homology: the canonical or classic TRPs, the vanilloid receptor TRPs, the melastatinΑ-Neurotoxin (1,330 words) [view diff] exact match in snippet view article find links to article
bond in the second "finger" loop. These classes have significant sequence homology and share the same three-dimensional structure, but have differingMetabotropic glutamate receptor 8 (708 words) [view diff] exact match in snippet view article find links to article
protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic propertiesPiscivorin (457 words) [view diff] exact match in snippet view article find links to article
masses between 20 and 30 kDa. They display significant amino acid sequence homology. Sixteen cysteine residues, forming 8 disulfide bonds, are strictlyKeratinase (748 words) [view diff] exact match in snippet view article find links to article
In the 1990s, they were defined as a serine proteases due to high sequence homology with alkaline protease, and their inhibition by serine protease inhibitorsEF-4 (1,173 words) [view diff] exact match in snippet view article find links to article
(November 1985). "GTP-binding membrane protein of Escherichia coli with sequence homology to initiation factor 2 and elongation factors Tu and G". Proc. NatlMetabotropic glutamate receptor 6 (868 words) [view diff] exact match in snippet view article find links to article
protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic propertiesPolinton (1,071 words) [view diff] exact match in snippet view article find links to article
selfish genetic elements, represented by labeled circles. Links between circles are color-coded by the gene whose sequence homology establishes the link.Prostatic acid phosphatase (1,451 words) [view diff] exact match in snippet view article find links to article
prostatic acid phosphatase: cDNA cloning, gene mapping and protein sequence homology with lysosomal acid phosphatase". Biochem. Biophys. Res. Commun. 160Group I catalytic intron (1,533 words) [view diff] exact match in snippet view article find links to article
PMID 10986228. Sandegren L, Sjöberg BM (May 2004). "Distribution, sequence homology, and homing of group I introns among T-even-like bacteriophages: evidenceMARK2 (1,143 words) [view diff] exact match in snippet view article find links to article
localization of D11S1226 to the human EMK1 gene at chromosome band 11q13 by sequence homology search". Cytogenet Cell Genet. 86 (1): 66–7. doi:10.1159/000015413Serum amyloid P component (744 words) [view diff] exact match in snippet view article find links to article
forming a ring approximately 95 across and 35 deep. Human SAP has 51% sequence homology with C-reactive protein (CRP), a classical acute phase response plasmaCYP1B1 (1,111 words) [view diff] exact match in snippet view article find links to article
of CYP1 family enzymes CYP1A1, CYP1A2, CYP1A6 and CYP1B1 based on sequence homology with CYP102". Toxicology. 139 (1–2): 53–79. doi:10.1016/S0300-483X(99)00098-0Direct factor Xa inhibitors (1,525 words) [view diff] exact match in snippet view article find links to article
metastasis, binds to sulfatide (Gal(3-SO4) beta 1-1Cer) and has a sequence homology with other proteins that bind sulfated glycoconjugates". The JournalΒ-Lactamase inhibitor (1,696 words) [view diff] exact match in snippet view article find links to article
groups known beta-lactamase enzymes into four groups according to sequence homology and presumed phylogenetic relationships. Classes A, C and D cleaveBacillus anthracis (4,674 words) [view diff] exact match in snippet view article find links to article
Ames Ancestor strains. H9401 has 99.679% sequence homology with Ames Ancestor with an amino acid sequence homology of 99.870%. H9401 has a circular chromosomeSignal peptide (1,741 words) [view diff] exact match in snippet view article find links to article
synthesized protein to the Sec61 channel, which shares structural and sequence homology with SecYEG, but is present in the endoplasmic reticulum. Both theUCSC Genome Browser (1,641 words) [view diff] exact match in snippet view article find links to article
in evolutionary time (this track includes 100 species), the less sequence homology remains, but functionally important regions of the genome (e.g., exonsSoluble guanylyl cyclase (1,167 words) [view diff] exact match in snippet view article find links to article
has no available structure, the PAS domain of a protein with high sequence homology to sGC has been crystallized (pdb code 2P04). The PAS domain of sGCYersinia enterocolitica (1,589 words) [view diff] case mismatch in snippet view article find links to article
Autoantigens and Proteins of Yersinia and Borrelia Share Amino Acid Sequence Homology That Includes Binding Motifs to HLA-DR Molecules and T-Cell Receptor"Innexin (1,309 words) [view diff] exact match in snippet view article find links to article
with the exception of echinoderms. Gap junction proteins with no sequence homology to connexins were initially identified in fruit flies. It was suggestedΒ-Lactamase inhibitor (1,696 words) [view diff] exact match in snippet view article find links to article
groups known beta-lactamase enzymes into four groups according to sequence homology and presumed phylogenetic relationships. Classes A, C and D cleaveAnders Krogh (846 words) [view diff] exact match in snippet view article find links to article
mixtures: a method for improved detection of weak but significant protein sequence homology". Comput. Appl. Biosci. 12 (4): 327–45. doi:10.1093/bioinformatics/12MCM2 (1,600 words) [view diff] exact match in snippet view article find links to article
Kearsey SE, Ansorge W, Werner D (1994). "A human nuclear protein with sequence homology to a family of early S phase proteins is required for entry into SSelectin (2,424 words) [view diff] exact match in snippet view article find links to article
inflammatory cytokines. These three types share a significant degree of sequence homology among themselves (except in the transmembrane and cytoplasmic domains)IGHG4 (360 words) [view diff] exact match in snippet view article find links to article
PMID 11257305. Ellison J, Hood L (Mar 1982). "Linkage and sequence homology of two human immunoglobulin gamma heavy chain constant region genes"Diglyceride acyltransferase (705 words) [view diff] exact match in snippet view article find links to article
Although both isozymes catalyze similar reactions, they share no sequence homology, which is similar to other DGATs reported in various organisms. TheGSTK1 (1,603 words) [view diff] exact match in snippet view article find links to article
"Thioredoxin-like domain of human kappa class glutathione transferase reveals sequence homology and structure similarity to the theta class enzyme". Protein ScienceCD23 (1,727 words) [view diff] exact match in snippet view article find links to article
Kawabe T, Yodoi J (Feb 1987). "Human lymphocyte Fc receptor for IgE: sequence homology of its cloned cDNA with animal lectins". Proceedings of the NationalMetabotropic glutamate receptor 7 (1,359 words) [view diff] exact match in snippet view article find links to article
protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic propertiesHomology directed repair (1,245 words) [view diff] exact match in snippet view article find links to article
must be present in the same nucleus a second DNA molecule containing sequence homology with the region to be repaired. In a diploid cell in G1 phase of theSERPINA2 (1,045 words) [view diff] exact match in snippet view article find links to article
Sifers RN, Kidd VJ, Woo SL (February 1988). "Molecular structure and sequence homology of a gene related to alpha 1-antitrypsin in the human genome". GenomicsKeratin 19 (1,536 words) [view diff] exact match in snippet view article find links to article
KRT19a and KRT19b, have been identified, which have significant sequence homology to KRT19 mRNA. Subsequently, attempts to detect the expression ofMinor spliceosome (1,249 words) [view diff] exact match in snippet view article find links to article
functional analogs of U4 and U6, respectively, they share only limited sequence homology (c. 40%). Furthermore, the sequence of U11 in comparison with U1,HLA-Y (212 words) [view diff] exact match in snippet view article find links to article
Rodriguez-Marino, S. G. (2004). "Identification of two pseudogenes with sequence homology to human and gorilla MHC class IA genes: Ancestral haplotype in theFimbrin (689 words) [view diff] exact match in snippet view article find links to article
in membrane ruffles, filopodia, stereocilia and adhesion plaques. Sequence homology and biochemical properties show that fimbrin is highly conserved fromHeteroscorpine (469 words) [view diff] exact match in snippet view article find links to article
HS-1 are both classified as scorpine-like peptides. Based on its sequence homology with other scorpine-like peptides, HS-1 is likely to be a voltage-gatedSister chromatid exchange (935 words) [view diff] exact match in snippet view article find links to article
be present, in the same nucleus, a second DNA molecule containing sequence homology with the region to be repaired. In a diploid cell in G1 phase of theHwp1 (363 words) [view diff] exact match in snippet view article find links to article
candidiasis showing hyphaes Hwp1 of Candida albicans shares similar sequence homology of amino acids with gliadin (α- and γ-gliadins) of gluten proteinIGHA2 (612 words) [view diff] exact match in snippet view article find links to article
PMID 6421489. S2CID 54312675. Ellison J, Hood L (Mar 1982). "Linkage and sequence homology of two human immunoglobulin gamma heavy chain constant region genes"Single-stranded binding protein (1,016 words) [view diff] exact match in snippet view article find links to article
equivalent of SSB in the nucleus of eukaryotic cells, though there is no sequence homology. The mitochondria of eukaryotic cells contain their own single strandedSecretoglobin (584 words) [view diff] exact match in snippet view article find links to article
bonds. Many have regulatory functions. The family was classified by sequence homology into 6 subfamilies in 2006. The human and mouse genomes only containPhospholipase A2 (2,452 words) [view diff] exact match in snippet view article find links to article
phospholipase C (see below). Phospholipases A2 can be classified based on sequence homology. Increased levels of lp-PLA2 are associated with cardiac disease,Margatoxin (1,803 words) [view diff] exact match in snippet view article find links to article
Margatoxin is classified as a "scorpion short toxin" by Pfam, showing sequence homology with other potassium channel blockers, such as charybdotoxin (44%)GsMTx-4 (1,193 words) [view diff] exact match in snippet view article find links to article
shares less than 50% of its sequence homology with all other known peptide toxins. The highest percentage of sequence homology is shared with other tarantulaAspartate transaminase (2,115 words) [view diff] exact match in snippet view article find links to article
from a common ancestral AST via gene duplication, and they share a sequence homology of approximately 45%. AST has also been found in a number of microorganismsPhytase (2,938 words) [view diff] exact match in snippet view article find links to article
PTP-like phosphoinositide/-inositol phosphatase PTEN, and significant sequence homology to the PTP domain of a type III-secreted virulence protein from PseudomonasMajor basic protein (1,515 words) [view diff] exact match in snippet view article find links to article
cDNA cloning of a novel factor produced by a human T-cell hybridoma: sequence homology with animal lectins". Mol. Immunol. 29 (4): 537–546. doi:10Laminin subunit gamma-1 (1,195 words) [view diff] exact match in snippet view article find links to article
complete amino acid sequence with the B1 chain reveals variability in sequence homology between different structural domains". J. Biol. Chem. 263 (14): 6751–8PFKFB3 (3,772 words) [view diff] exact match in snippet view article find links to article
signaling. The four PFKFB isoforms share high (85%) ‘2-Kase/2-Pase core’ sequence homology, but have different properties based on variable N- and C- terminalAlkhurma virus (1,781 words) [view diff] exact match in snippet view article find links to article
Kyasanur Forest disease (KFD), with which it shares 89% nucleotide sequence homology. Close similarities indicate that these viruses diverged 700 yearsYeast flocculation (984 words) [view diff] exact match in snippet view article find links to article
reports suggest genes encoding lectin-like proteins exhibit close sequence homology. Furthermore, it seems that FLO genes have interchangeable functionsPOPDC2 (511 words) [view diff] exact match in snippet view article find links to article
is located in the cytoplasmic part of the protein displays limited sequence homology to other proteins, while sequence conservation amongst Popeye proteinsMucorpepsin (279 words) [view diff] exact match in snippet view article find links to article
characterization of Mucor pusillus aspartic proteinase. Amino acid sequence homology with the other aspartic proteinases, disulfide bond arrangement andATG8 (2,085 words) [view diff] exact match in snippet view article find links to article
conserved GABARAP domain. Even though Atg8 does not show a clear sequence homology to ubiquitin, its crystal structure reveals a conserved ubiquitin-likePeroxiredoxin (1,724 words) [view diff] exact match in snippet view article find links to article
PMID 15581580. Chae HZ, Rhee SG (May 1994). "A thiol-specific antioxidant and sequence homology to various proteins of unknown function". BioFactors. 4 (3–4): 177–80Pregnancy zone protein (4,155 words) [view diff] exact match in snippet view article find links to article
“Partial primary structure of human pregnancy zone protein: Extensive sequence homology with human a2-macroglobulin (plasma proteins/evolution/acute-phaseHongotoxin (268 words) [view diff] exact match in snippet view article find links to article
peptide. HgTX1 is 39 amino acids long and shows an overall amino acid sequence homology of 89% to margatoxin (MgTX). Hongotoxin (HgTX) targets are Shaker-typeCyclooxygenase (1,672 words) [view diff] exact match in snippet view article find links to article
approximately 70 and 72 kDa, respectively, and having 65% amino acid sequence homology and near-identical catalytic sites. Both proteins have three domains:Cyclin-dependent kinase complex (2,258 words) [view diff] exact match in snippet view article find links to article
These distinct roles, however, do not significantly differ with the sequence homology between the CDK components. In particular, among these known structuresLaminin subunit gamma-1 (1,195 words) [view diff] exact match in snippet view article find links to article
complete amino acid sequence with the B1 chain reveals variability in sequence homology between different structural domains". J. Biol. Chem. 263 (14): 6751–8Histidine kinase (2,109 words) [view diff] exact match in snippet view article find links to article
HK family. In contrast, the cytoplasmic domain tends to have high sequence homology and contains several well-known motifs. These motifs include the HProgastricsin (920 words) [view diff] exact match in snippet view article find links to article
(progastricsin). Isolation of cDNA clones, localization to chromosome 6, and sequence homology with pepsinogen A". J. Biol. Chem. 264 (1): 375–9. doi:10.1016/S0021-9258(17)31268-1Interleukin 9 (2,308 words) [view diff] exact match in snippet view article find links to article
"Hematopoietin sub-family classification based on size, gene organization and sequence homology". Current Biology. 3 (9): 573–581. Bibcode:1993CBio....3..573B. doi:10Guanine nucleotide exchange factor (2,253 words) [view diff] exact match in snippet view article find links to article
these GEF families are not structurally related and do not share sequence homology. These GEF domains appear to be evolutionarily unrelated despite similarGTx1-15 (409 words) [view diff] exact match in snippet view article find links to article
in proteolytic, thermal, and chemical stability. GTx1-15 displays sequence homology with other ion channel toxins from several spider species. It is homologousPleckstrin (564 words) [view diff] exact match in snippet view article find links to article
not a substrate for protein kinase C. The two proteins share 65% sequence homology and have a size of about 47 kilodaltons. As of 2024, no high-resolutionProtein phosphatase (2,519 words) [view diff] exact match in snippet view article find links to article
evolutionarily related to the major family of Ser/Thr PPs and has no sequence homology to ancient PPP enzymes. The current assumption is that PPMs evolvedPiggyBac transposon system (1,285 words) [view diff] exact match in snippet view article find links to article
be 100 to 500 copies of a fossil element called LOOPER, which has sequence homology to piggyBac, terminates in 5' CCY....GGG 3', and apparently targetsDeath receptor 3 (1,592 words) [view diff] exact match in snippet view article find links to article
Tschopp J (Jan 1997). "TRAMP, a novel apoptosis-mediating receptor with sequence homology to tumor necrosis factor receptor 1 and Fas(Apo-1/CD95)". ImmunityG protein-coupled receptor kinase (2,053 words) [view diff] exact match in snippet view article find links to article
GRK4, GRK5 and GRK6), alone or bound to ligands. Overall, GRKs share sequence homology and domain organization in which the central protein kinase catalyticPregnancy zone protein (4,155 words) [view diff] exact match in snippet view article find links to article
“Partial primary structure of human pregnancy zone protein: Extensive sequence homology with human a2-macroglobulin (plasma proteins/evolution/acute-phaseM2 proton channel (2,294 words) [view diff] exact match in snippet view article find links to article
is a functional homolog of influenza A protein. There is almost no sequence homology between influenza AM2 and BM2 except for the HXXXW sequence motifPenicillopepsin (274 words) [view diff] exact match in snippet view article find links to article
"Penicillopepsin from Penicillium janthinellum crystal structure at 2.8 A and sequence homology with porcine pepsin". Nature. 266 (5598): 140–5. doi:10.1038/266140a0Lyssavirus (1,392 words) [view diff] exact match in snippet view article find links to article
lyssavirus genus can be divided into four phylogroups based upon DNA sequence homology. Phylogroup I includes viruses, such as Rabies virus, Duvenhage virusRyanodine receptor (2,290 words) [view diff] exact match in snippet view article find links to article
single isoform. In non-metazoan species, calcium-release channels with sequence homology to RyRs can be found, but they are shorter than the mammalian onesCREB-binding protein (5,270 words) [view diff] exact match in snippet view article find links to article
interchangeably as CBP/p300. This is a reasonable amalgamation given the sequence homology, structural similarity and binding behaviors of these two proteinsPearson syndrome (1,198 words) [view diff] case mismatch in snippet view article find links to article
Craigen, William J.; Schmitt, Eric S.; Wong, Lee-Jun C. (2010). "Sequence Homology at the Breakpoint and Clinical Phenotype of Mitochondrial DNA DeletionMetabotropic glutamate receptor 2 (2,647 words) [view diff] exact match in snippet view article find links to article
protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties:IGHG2 (779 words) [view diff] exact match in snippet view article find links to article
3.1048. PMID 6774012. Ellison J, Hood L (Mar 1982). "Linkage and sequence homology of two human immunoglobulin gamma heavy chain constant region genes"PyrD leader (380 words) [view diff] exact match in snippet view article find links to article
dihydroorotate dehydrogenase is dependent on a conserved loop identified by sequence homology, mutagenesis, and limited proteolysis". Biochemistry. 38 (10): 2899–2908GAPVD1 (794 words) [view diff] exact match in snippet view article find links to article
formation of plasma membrane phosphatidylinositol-3-phosphate. Based on sequence homology, mammalian Gapex-5 has been shown to have an amino-terminal Ras GAPLSM1 (802 words) [view diff] exact match in snippet view article find links to article
Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2). Sm-like proteins containWFDC2 (825 words) [view diff] exact match in snippet view article find links to article
1992). "A major human epididymis-specific cDNA encodes a protein with sequence homology to extracellular proteinase inhibitors". Biol Reprod. 45 (2): 350–7Juno (protein) (538 words) [view diff] exact match in snippet view article
Juno's essential role in the fertility of female mice. Based on a sequence homology search for genes relate to the folate receptor, the gene for folateTNNT3 (1,957 words) [view diff] exact match in snippet view article find links to article
complex) isoform gene, and fsTnT is linked with fsTnI genes (Fig. 1). Sequence homology and protein epitope allosteric similarity data suggest that TnT geneMetabotropic glutamate receptor 1 (2,342 words) [view diff] exact match in snippet view article find links to article
protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic propertiesMLLT3 (683 words) [view diff] exact match in snippet view article find links to article
9, and 19 involved in 11q23 abnormalities in acute leukemia share sequence homology and/or common motifs". Proc Natl Acad Sci U S A. 90 (10): 4631–5.ARL6IP4 (710 words) [view diff] exact match in snippet view article find links to article
and a basic cluster. Its function(s) are unknown. However, due to sequence homology of its protein with SR splicing factors, it is widely believed thatJanice E. Clements (1,015 words) [view diff] exact match in snippet view article find links to article
Wong-Staal F, Gallo RC, Clements JE, Narayan O, Gilden RV (Jan 1985). "Sequence homology and morphologic similarity of HTLV-III and visna virus, a pathogenicLSM3 (876 words) [view diff] exact match in snippet view article find links to article
Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteinsKimmen Sjölander (504 words) [view diff] exact match in snippet view article find links to article
mixtures: a method for improved detection of weak but significant protein sequence homology", Bioinformatics, 12 (4): 327–345, doi:10.1093/bioinformatics/12.4Histone deacetylase (3,181 words) [view diff] exact match in snippet view article find links to article
deacetylase superfamily. HDACs, are classified in four classes depending on sequence homology to the yeast original enzymes and domain organization: HDAC (exceptS-Adenosyl methionine (2,413 words) [view diff] exact match in snippet view article find links to article
active sites. Most enzymes with this capability share a region of sequence homology that includes the motif CxxxCxxC or a close variant. This sequenceDNA clamp (2,044 words) [view diff] exact match in snippet view article find links to article
called gp45 that is a trimer similar in structure to PCNA but lacks sequence homology to either PCNA or the bacterial beta clamp. The beta clamp is a specificDDX5 (1,305 words) [view diff] exact match in snippet view article find links to article
PMID 2349099. Ford MJ, Anton IA, Lane DP (1988). "Nuclear protein with sequence homology to translation initiation factor eIF-4A". Nature. 332 (6166): 736–8Richard Bonneau (880 words) [view diff] exact match in snippet view article find links to article
demonstrate the ability to predict protein structure in the absence of sequence homology. Using IBM's World Community Grid to carry out folding of whole proteomesIL22RA2 (1,844 words) [view diff] exact match in snippet view article find links to article
monomeric cytokine receptor protein. IL-22BP shares approximately 34% sequence homology with the extracellular domain of one subunit of the heterodimericAvian metapneumovirus (1,233 words) [view diff] exact match in snippet view article find links to article
than to the subtype C. By comparison type C has a higher amino acid sequence homology to human MPV. HMPV and AMPV-C share up to 80% of the amino acid identityStephen J. Benkovic (3,234 words) [view diff] exact match in snippet view article find links to article
Genomic analysis of multiple DHFR sequences revealed low overall DNA sequence homology (30%), but surprisingly high conservation in the same regions whoseClostridium perfringens beta toxin (857 words) [view diff] exact match in snippet view article find links to article
genetic analysis of beta-toxin of Clostridium perfringens reveals sequence homology with alpha-toxin, gamma-toxin, and leukocidin of Staphylococcus aureus"Thioredoxin reductase (2,156 words) [view diff] exact match in snippet view article find links to article
E. coli are -Cys-Ala-Thr-Cys-. Mammalian TrxRs have a much higher sequence homology with glutathione reductase than E. coli. The active-site Cys residuesMatthew P. Scott (544 words) [view diff] case mismatch in snippet view article find links to article
"Structural Relationships among Genes That Control Development: Sequence Homology between the Antennapedia, Ultrabithorax, and Fushi Tarazu Loci ofTityustoxin peptide 2 (489 words) [view diff] exact match in snippet view article find links to article
sequence from TsPep3 only in one amino acid and TsPep1 shows 58,6% of sequence homology with Tspep2 and TsPep3. Eight cysteines establish four disulfide bridgesLSM7 (789 words) [view diff] exact match in snippet view article find links to article
Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteinsEukaryotic translation elongation factor 1 alpha 1 (2,672 words) [view diff] exact match in snippet view article find links to article
eEF1A possesses two paralogs, eEF1A1 and eEF1A2, with high amino acid sequence homology (approximately 90% identity). The sequences of their promoter regionsEcdysone receptor (1,042 words) [view diff] exact match in snippet view article find links to article
(FXR) and retinoid X receptor (RXR) proteins, respectively. Based on sequence homology considerations, some researchers reserve the term USP for the EcRE. coli nitroreductase (223 words) [view diff] exact match in snippet view article find links to article
Escherichia coli major nitroreductase exhibiting a high amino acid sequence homology to Frp, a Vibrio harveyi flavin oxidoreductase". Journal of BacteriologyCapripoxvirus (986 words) [view diff] exact match in snippet view article find links to article
strains showed that all capripoxviruses have a very similar nucleotide sequence homology. Strains were also proven to not all be host-specific. All CapripoxvirusesInterferon alpha-1 (2,894 words) [view diff] exact match in snippet view article find links to article
IFN-Omega genes. The human IFNA gene family shares 70-80% amino acid sequence homology, and about 35% identity with IFNB. The high degree of amino-acid sequenceIGHE (1,314 words) [view diff] exact match in snippet view article find links to article
PMID 6421489. S2CID 54312675. Ellison J, Hood L (March 1982). "Linkage and sequence homology of two human immunoglobulin gamma heavy chain constant region genes"High Plains wheat mosaic emaravirus (582 words) [view diff] exact match in snippet view article find links to article
precursor, nucleocapsid, and P4 proteins of WMoV exhibited limited sequence homology with the orthologous proteins of other emaraviruses, while proteinsHDAC3 (2,493 words) [view diff] exact match in snippet view article find links to article
deacetylase superfamily (comprising four classes based on function and DNA sequence homology) that is recruited to enhancers to modulate both the epigenome andORM1 (960 words) [view diff] exact match in snippet view article find links to article
R (1985). "Structure of the human alpha 1-acid glycoprotein gene: sequence homology with other human acute phase protein genes". Nucleic Acids Res. 13UVR8 (989 words) [view diff] exact match in snippet view article find links to article
is a β-propeller protein with 7 blade-shaped β-sheets. It shares sequence homology with mammalian proteins involved in regulating chromatin condensationCalcium-activated potassium channel (2,067 words) [view diff] exact match in snippet view article find links to article
known human calcium-activated potassium channel grouped according to sequence homology of transmembrane hydrophobic cores: Though not implied in the nameSnakehead rhabdovirus (1,078 words) [view diff] exact match in snippet view article find links to article
are similar in size, including approximately 110-122 codons, little sequence homology is evident. Coding sequences of its glycoprotein (G) genes were foundIntermediate filament (3,168 words) [view diff] exact match in snippet view article find links to article
revealed that the two types of keratins share only about 30% amino acid sequence homology but share similar patterns of secondary structure domains. As suggestedMetabotropic glutamate receptor 3 (3,074 words) [view diff] exact match in snippet view article find links to article
protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic propertiesFarnesyl-diphosphate farnesyltransferase (3,078 words) [view diff] exact match in snippet view article find links to article
isoprenoid biosynthetic enzymes, although these enzymes do not share sequence homology. Squalene synthase (SQS) catalyzes the reductive dimerization of farnesylBmK NSPK (448 words) [view diff] exact match in snippet view article find links to article
previously discovered Kv1.3 channel blocker, BmK NSPK showed 79% sequence homology. Furthermore, BmKTX and BmK NSPK also show structural similaritiesInterleukin 26 (2,809 words) [view diff] exact match in snippet view article find links to article
AK155, IL-26 was categorized in the IL-10 cytokine family due to sequence homology and secondary structure similarities. The IL-26 expression was initiallyPhospholipase D (3,454 words) [view diff] exact match in snippet view article find links to article
phospholipase D has been identified in mammalian cells: PLD1 and PLD2 (53% sequence homology), each encoded by distinct genes. PLD activity appears to be presentNuclear pore glycoprotein p62 (2,260 words) [view diff] exact match in snippet view article find links to article
nucleoporin p62 and the essential yeast nuclear pore protein NSP1 show sequence homology and a similar domain organization". Eur. J. Cell Biol. 55 (1): 17–30Cannabinoid receptor (3,086 words) [view diff] exact match in snippet view article find links to article
fact be characterised as a cannabinoid receptor, on the basis of sequence homology at the binding site. Subsequent studies showed that GPR55 does indeedTIM barrel (4,828 words) [view diff] exact match in snippet view article find links to article
They catalyze 2 successive reactions in the pathway, possess 25% sequence homology, and possess root-mean-square deviations (RMSDs) between 1.5-2 Å,Non-receptor tyrosine kinase (2,716 words) [view diff] exact match in snippet view article find links to article
a region of positively charged residues, a short region with low sequence homology, SH3 and SH2 domains, a tyrosine kinase domain, and a short carboxy-terminalCD90 (3,170 words) [view diff] exact match in snippet view article find links to article
cells and anti Thy-1.1 with vimentin, and were suggested to be due to sequence homology by studies done more than 20 years back. Thy-1, like many other GPIAralkylamine N-acetyltransferase (2,982 words) [view diff] exact match in snippet view article find links to article
which consists 10,000 acetyltransferases, named so because of their sequence homology to a class of eukaryotic transcription factors, therein the yeastLa Jolla Institute for Immunology (1,496 words) [view diff] case mismatch in snippet view article find links to article
March 25, 2024. "BioCentury". BioCentury. Retrieved 2020-12-09. "A Sequence Homology and Bioinformatic Approach Can Predict Candidate Targets for ImmuneLSm (5,020 words) [view diff] exact match in snippet view article find links to article
seven LSm proteins in this ring is not known, but based on amino acid sequence homology with the Sm proteins, it is speculated that the snRNA (in the 5' toHemopexin (2,562 words) [view diff] exact match in snippet view article find links to article
placed randomly; they fell in the center of the region of amino acid sequence homology in strikingly similar locations in 6 of the 10 units and in a symmetricGYPB (3,580 words) [view diff] exact match in snippet view article find links to article
acids having been determined earlier that year. The gene has 97% sequence homology with the glycophorin A gene from the 5' UTR approximately 1 kilobasePhosphatidylethanolamine binding protein 1 (1,010 words) [view diff] exact match in snippet view article find links to article
1016/S0163-4453(05)80037-4. PMID 1602151. Tohdoh N, Tojo S, Agui H, Ojika K (1995). "Sequence homology of rat and human HCNP precursor proteins, bovine phosphatidylethanolamine-bindingListeria ivanovii (1,365 words) [view diff] exact match in snippet view article find links to article
ivanovii is a large repeat protein which shows only limited amino acid sequence homology to ActA from Listeria monocytogenes". FEMS Microbiology Letters. 126AFF1 (1,292 words) [view diff] exact match in snippet view article find links to article
9, and 19 involved in 11q23 abnormalities in acute leukemia share sequence homology and/or common motifs". Proceedings of the National Academy of SciencesJunhyong Kim (883 words) [view diff] exact match in snippet view article find links to article
identifying G Protein-Coupled Receptors (GPCR) without using primary sequence homology, which led to the cloning of olfactory receptors in insects. AfterPIM1 (2,973 words) [view diff] exact match in snippet view article find links to article
that there is redundancy in the function of this kinase. In fact, sequence homology searches have shown that two other Pim-1-like kinases, Pim-2 and Pim-3Metabotropic glutamate receptor 5 (3,218 words) [view diff] exact match in snippet view article find links to article
protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacological propertiesPIM1 (2,973 words) [view diff] exact match in snippet view article find links to article
that there is redundancy in the function of this kinase. In fact, sequence homology searches have shown that two other Pim-1-like kinases, Pim-2 and Pim-3Chorismate mutase (1,354 words) [view diff] exact match in snippet view article find links to article
Knowles, et al. E. coli and Yeast chorismate mutase have a limited sequence homology, but their active sites contain similar residues. The active siteOdK2 (808 words) [view diff] exact match in snippet view article find links to article
OdK2 is further classified as α-KTx 3.11 as it presents significant sequence homology with toxins from the α-KTx 3.x sub-family, especially Bs6, AgitoxinSpinoxin (657 words) [view diff] exact match in snippet view article find links to article
and its family as "short-chain scorpion toxins". Spinoxin has 82% sequence homology with maurotoxin (MTX; α-KTx6.2). Most short-chain scorpion toxinsLysyl oxidase (3,147 words) [view diff] exact match in snippet view article find links to article
lysyl oxidase and assignment of the gene to chromosome 5 (extensive sequence homology with the murine ras recision gene)". Matrix. 12 (3): 242–8. doi:10Gene conversion (3,004 words) [view diff] exact match in snippet view article find links to article
meiosis pairs up with another chromatid, as can occur because of sequence homology, DNA strand transfer can occur followed by mismatch repair. This canComplement receptor 1 (2,906 words) [view diff] exact match in snippet view article find links to article
repeats (CCPs) or sushi domains), each having 60 to 70 amino acids. The sequence homology between SCRs ranges between 60 and 99 percent. The transmembrane regionNon-receptor tyrosine kinase (2,716 words) [view diff] exact match in snippet view article find links to article
a region of positively charged residues, a short region with low sequence homology, SH3 and SH2 domains, a tyrosine kinase domain, and a short carboxy-terminalATCase/OTCase family (560 words) [view diff] exact match in snippet view article find links to article
ornithine carbamoyltransferase from Pseudomonas aeruginosa. Extensive sequence homology with the anabolic ornithine carbamoyltransferases of Escherichia coli"Dihydroorotate dehydrogenase (quinone) (677 words) [view diff] exact match in snippet view article
dihydroorotate dehydrogenase is dependent on a conserved loop identified by sequence homology, mutagenesis, and limited proteolysis". Biochemistry. 38 (10): 2899–908Junhyong Kim (883 words) [view diff] exact match in snippet view article find links to article
identifying G Protein-Coupled Receptors (GPCR) without using primary sequence homology, which led to the cloning of olfactory receptors in insects. AfterRecombination-activating gene (2,419 words) [view diff] exact match in snippet view article find links to article
DDE family recombinases, transposases or integrases. Based on core sequence homology, it is believed that RAG1 evolved from a transposase from the TransibChemokine (2,916 words) [view diff] exact match in snippet view article find links to article
identical to each other; that is, they share gene sequence and amino acid sequence homology. They all also possess conserved amino acids that are important forCalpastatin (1,016 words) [view diff] exact match in snippet view article find links to article
Y, Shimada M, et al. (1991). "cDNA cloning of human calpastatin: sequence homology among human, pig, and rabbit calpastatins". J. Enzym. Inhib. 3 (1):Variant surface glycoprotein (3,678 words) [view diff] exact match in snippet view article find links to article
made up of N terminal domain of around 300–350 amino acids with low sequence homology (13–30% identity), and a more conserved C terminal domain of ~100Brainbow (1,845 words) [view diff] exact match in snippet view article find links to article
emission spectra overlap minimally, and because they share minimal sequence homology, allowing for the design of selective antibodies that can be usedCarbetocin (1,913 words) [view diff] exact match in snippet view article find links to article
respiratory distress and postpartum hemorrhage. Due to oxytocin's close sequence homology with vasopressin, oxytocin analogs often bind with much lower affinityMyceliophthora thermophila (1,360 words) [view diff] exact match in snippet view article find links to article
been observed through phylogenetic analysis to bear very strong DNA sequence homology to M. thermophila. As its name implies, M. thermophila is a thermophilicArthropod defensin (1,256 words) [view diff] exact match in snippet view article find links to article
dipteran Phormia terranovae of two insect antibacterial peptides with sequence homology to rabbit lung macrophage bactericidal peptides". Proceedings of theGlycophorin A (4,101 words) [view diff] exact match in snippet view article find links to article
over event. The GypA gene itself consists of 7 exons and has 97% sequence homology with GypB and GypE from the 5' untranslated transcription region (UTR)Photosynthetic reaction centre protein family (2,100 words) [view diff] exact match in snippet view article find links to article
from cyanobacteria, algae and plants only show approximately 15% sequence homology with the L and M subunits, however the conserved amino acids correspondSuperantigen (3,559 words) [view diff] exact match in snippet view article find links to article
relatively conserved among the different subgroups. More important than sequence homology, the 3D structure is very similar among different SAgs resulting inIndoleamine 2,3-dioxygenase 2 (1,067 words) [view diff] exact match in snippet view article find links to article
enzymes originating by gene duplication and sharing high level (43%) of sequence homology, they differentiate by their kinetics, function and expression patternProteasome accessory factor E (760 words) [view diff] exact match in snippet view article find links to article
eukaryotic PA26 and PA28 activator proteins, despite the absence of sequence homology between PafE and these proteins. Nevertheless, the length of the PafEPA clan of proteases (1,687 words) [view diff] exact match in snippet view article find links to article
nucleophile (C=cysteine proteases, S=serine proteases). Despite the lack of sequence homology for the PA clan as a whole, individual families within it can be identifiedLight-dependent reactions (3,452 words) [view diff] exact match in snippet view article find links to article
472. Widger WR, Cramer WA, Herrmann RG, Trebst A (February 1984). "Sequence homology and structural similarity between cytochrome b of mitochondrial complexLSM2 (1,309 words) [view diff] exact match in snippet view article find links to article
Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteinsHsp27 (3,341 words) [view diff] exact match in snippet view article find links to article
the C-terminus. These domains consist of 80 to 100 residues with sequence homology between 20% and 60% and fold into β-sheets, which are important forBranched-chain amino acid aminotransferase (3,560 words) [view diff] exact match in snippet view article find links to article
1% homology with each other. These isoforms also share around 30% sequence homology to the human and yeast (Saccharomyces cerevisiae) isoforms. BCAT1Minichromosome maintenance (3,042 words) [view diff] exact match in snippet view article find links to article
involved in DNA replication, directly or indirectly, but have no sequence homology to the Mcm2-7 family. MCM2-7 is required for both DNA replicationInterleukin (4,194 words) [view diff] exact match in snippet view article find links to article
"Hematopoietin sub-family classification based on size, gene organization and sequence homology". Current Biology. 3 (9): 573–81. Bibcode:1993CBio....3..573B. doi:10CgNa toxin (906 words) [view diff] exact match in snippet view article find links to article
sodium-channel type 1 toxins. CgNa shares structural similarities and sequence homology with other anemone type 1 toxins such as ApA, ApB and ATX, and withLRRC24 (941 words) [view diff] exact match in snippet view article find links to article
conserved in Euteleostomi with the exception of Aves. Also, based on sequence homology analysis, distant orthologs of LRRC24 are also conserved in invertebratesVasant Honavar (8,139 words) [view diff] case mismatch in snippet view article find links to article
(2014). "RNABindRPlus: A Predictor that Combines Machine Learning and Sequence Homology-Based Methods to Improve the Reliability of Predicted RNA-BindingCST4 (1,022 words) [view diff] exact match in snippet view article find links to article
acid sequence of SAP-1, an acidic protein of human whole saliva, and sequence homology with human gamma-trace". J. Biochem. 96 (2): 489–98. doi:10.1093/oxfordjournalsCalliphora vomitoria (3,201 words) [view diff] exact match in snippet view article find links to article
"Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins". Proceedings of the National Academy ofWARS (gene) (1,042 words) [view diff] exact match in snippet view article
cloning and characterization of an interferon induced human cDNA with sequence homology to a mammalian peptide chain release factor". The EMBO Journal. 11Makatoxin-3 (1,017 words) [view diff] exact match in snippet view article find links to article
peptide at the N-terminal, and four disulfide bonds. It has a high sequence homology (90% identity) with two other toxins from the same Makatoxin proteinCytochrome b6f complex (2,121 words) [view diff] exact match in snippet view article find links to article
PMID 24931468. Widger WR, Cramer WA, Herrmann RG, Trebst A (Feb 1984). "Sequence homology and structural similarity between cytochrome b of mitochondrial complexHomeobox (4,469 words) [view diff] exact match in snippet view article find links to article
"Structural relationships among genes that control development: sequence homology between the Antennapedia, Ultrabithorax, and fushi tarazu loci ofYARS (1,096 words) [view diff] exact match in snippet view article find links to article
First EA (Jun 1997). "Human tyrosyl-tRNA synthetase shares amino acid sequence homology with a putative cytokine". J Biol Chem. 272 (22): 14420–5. doi:10Rabconnectin-3A (1,316 words) [view diff] exact match in snippet view article find links to article
It was discovered using a comparative genomics approach that found sequence homology to CpY, a gene found in the sex determining region of the Y chromosomeDrosomycin (1,251 words) [view diff] exact match in snippet view article find links to article
Drosophila induces the synthesis of a potent antifungal peptide with sequence homology to plant antifungal peptides". The Journal of Biological ChemistryPRC1 (1,804 words) [view diff] exact match in snippet view article find links to article
distinct isoforms of PRC1 have been observed. Additionally, PRC1 has sequence homology with Ase1 in yeasts, SPD-1 (spindle defective 1) in C. elegans, FeoHDAC7 (2,058 words) [view diff] exact match in snippet view article find links to article
transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologousGluten immunochemistry (5,077 words) [view diff] exact match in snippet view article find links to article
called MHC class I polypeptide-related sequence A and B. Discovered by sequence homology analysis these proteins are found on the surface of enterocytes ofWARS (gene) (1,042 words) [view diff] exact match in snippet view article
cloning and characterization of an interferon induced human cDNA with sequence homology to a mammalian peptide chain release factor". The EMBO Journal. 11VPS26A (1,458 words) [view diff] exact match in snippet view article find links to article
Vps26B share a similar bilobal β-sandwich structure and possess 70% sequence homology. However, these two paralogues distinctly differ on the surface patchCytochrome d (1,122 words) [view diff] exact match in snippet view article find links to article
been determined (PDB: 5IR6, 5DOQ). The third subunit does not share sequence homology with the third subunit proteobacteria, but does come into the assembliesProtein mass spectrometry (3,815 words) [view diff] exact match in snippet view article find links to article
sequencing can be difficult. Therefore, it may be necessary to utilize a sequence homology search application to work in tandem between a database search andΑ-Bungarotoxin (5,030 words) [view diff] exact match in snippet view article find links to article
toxicity. The α-bungarotoxin polypeptide chain shows significant sequence homology with other neurotoxins from cobra and sea snake venoms, particularlySWI/SNF (3,899 words) [view diff] exact match in snippet view article find links to article
ATPase SMARCA4 shows similar features, based on the high degree of sequence homology with yeast Snf2. The interface between two subunits, BAF155 (SMARCC1)SBDS (1,580 words) [view diff] exact match in snippet view article find links to article
Shwachman-Bodian-Diamond syndrome. It shares distant structural and sequence homology to a protein named YHR087W found in the yeast Saccharomyces cerevisiaeHydrogenobacter thermophilus (1,385 words) [view diff] exact match in snippet view article find links to article
It was also observed that there is significant level of protein sequence homology between the CCL protein and the C-terminal region of ATP citrate lyaseJingmenvirus (1,195 words) [view diff] exact match in snippet view article find links to article
relatives. The JMTV genome has four segments, two containing genes with sequence homology to non-structural proteins found in flaviviruses, including methyltransferaseGlutathione S-transferase (4,278 words) [view diff] exact match in snippet view article find links to article
classes from the cytosolic superfamily of GSTs possess more than 40% sequence homology, those from other classes may have less than 25%. Cytosolic GSTs areEstrogen receptor (3,818 words) [view diff] exact match in snippet view article find links to article
heterodimers. Estrogen receptor alpha and beta show significant overall sequence homology, and both are composed of five domains designated A/B through F (listedCeramide kinase (1,881 words) [view diff] exact match in snippet view article find links to article
contains 13 exons, and is approximately 4.5kb in length. CERK shares sequence homology with sphingosine kinase type I, including an N-terminal pleckstrinCathepsin E (2,278 words) [view diff] exact match in snippet view article find links to article
cathepsin E. Predicted sequence, localization to chromosome 1, and sequence homology with other aspartic proteinases". The Journal of Biological ChemistryATX-II (1,221 words) [view diff] exact match in snippet view article find links to article
of sodium channels, they belong to distinct families and share no sequence homology. The toxins AFT-II (from Anthopleura fuscoviridis) and ATX-II differSingle-nucleotide polymorphism (6,179 words) [view diff] exact match in snippet view article find links to article
protein function based on physical properties of the amino acid and sequence homology. LIST (Local Identity and Shared Taxa) estimates the potential deleteriousnessEvolution by gene duplication (1,822 words) [view diff] exact match in snippet view article find links to article
non-functional . Such non-functional remnants of genes, with detectable sequence homology, can sometimes still be found in genomes and are called pseudogenesP-type ATPase (5,158 words) [view diff] exact match in snippet view article find links to article
characteristic of the haloacid dehalogenase (HAD) superfamily, as predicted by sequence homology. The HAD superfamily functions on the common theme of an aspartateParasutterella (1,239 words) [view diff] exact match in snippet view article find links to article
Parasutterella and Sutterella contain several similarities, including sequence homology, inability to grow in an aerobic environment, oxidase- and catalase-negativeGenomic phylostratigraphy (1,814 words) [view diff] exact match in snippet view article find links to article
inability of bioinformatic tools (BLAST or any other tool to detect sequence homology) to trace back homology when protein sequences are small and evolveSLPI (2,247 words) [view diff] exact match in snippet view article find links to article
"Purification and characterization of elastase-specific inhibitor. Sequence homology with mucus proteinase inhibitor". Biological Chemistry Hoppe-SeylerGlucokinase (5,668 words) [view diff] exact match in snippet view article find links to article
production of the "liver isoform." The two promoters have little or no sequence homology and are separated by a 30 kbp sequence which has not yet been shownReplisome (3,700 words) [view diff] exact match in snippet view article find links to article
significant degree of structural conservation is observed without sequence homology further underpins the significance of these structural solutions toCarnitine palmitoyltransferase II deficiency (3,167 words) [view diff] exact match in snippet view article find links to article
al. The human homolog of the CPT II enzyme shows 82.2% amino acid sequence homology with the rat protein. Significant structural and functional informationAsKC11 (1,177 words) [view diff] exact match in snippet view article find links to article
INKDCLLPKVVGFCRARFPRYYYNSSSRRCEKFIYGGCGGNANNFSSYYECHIKCFGPR AsKC11 exhibits sequence homology with other venom Kunitz-type peptides from various species, such asDNA adenine methylase (1,844 words) [view diff] exact match in snippet view article find links to article
infect E. coli. In a study it was identified that despite sharing any sequence homology, the E. coli and T4 Dam methylase amino acids sequences share sequenceEriko Takano (763 words) [view diff] case mismatch in snippet view article find links to article
Marnix H.; Takano, Eriko; Breitling, Rainer (2013-02-14). "Detecting Sequence Homology at the Gene Cluster Level with MultiGeneBlast". Molecular BiologyTransient receptor potential channel (5,514 words) [view diff] exact match in snippet view article find links to article
the transmebrane segments of PKD1-like proteins have substantial sequence homology with TRP channels, indicating they may simply have diversified greatlyInterleukin-1 family (6,005 words) [view diff] exact match in snippet view article find links to article
Golgi apparatus. Mouse, rat and rabbit IL-1ra show 77, 75, and 78% sequence homology to human IL-1ra. L-1ra shows approximately 30% homology to IL-1β atFossil (10,815 words) [view diff] exact match in snippet view article find links to article
using phylogenetics, can compare protein amino acid or nucleotide sequence homology (i.e., similarity) to evaluate taxonomy and evolutionary distancesAryl hydrocarbon receptor (5,962 words) [view diff] exact match in snippet view article find links to article
PAS-B, which are stretches of 200–350 amino acids that exhibit a high sequence homology to the protein domains that were originally found in the DrosophilaSirtuin 2 (3,442 words) [view diff] exact match in snippet view article find links to article
G, Murnane JP (Jun 1999). "Characterization of a human gene with sequence homology to Saccharomyces cerevisiae SIR2". Gene. 234 (1): 161–68. doi:10DNA polymerase (7,053 words) [view diff] exact match in snippet view article find links to article
describing the resulting DNA polymerase processivity increase. Based on sequence homology, DNA polymerases can be further subdivided into seven different families:Emodepside (1,862 words) [view diff] exact match in snippet view article find links to article
and share 21% amino acid identity with each other (the amino acid sequence homology LAT-1 shares with rat, bovine and human latrophilins has been shownPolyadenylation (7,095 words) [view diff] exact match in snippet view article find links to article
reveals discrete functions in RNA degradation, polyadenylation, and sequence homology with exosome proteins". The Plant Cell. 15 (9): 2003–19. doi:10.1105/tpcBeta-lactamase (6,263 words) [view diff] exact match in snippet view article find links to article
specific hydrolysis profile. Therefore, there is as little as 20% sequence homology among some of the members of this family. However, recent additionsIntrepicalcin (1,129 words) [view diff] exact match in snippet view article find links to article
Based on the fact that intrepicalcin and imperacalcin have a 70% sequence homology (see Homology), it is predicted that intrepicalcin has a coiled, sphericalAutophagy (8,905 words) [view diff] exact match in snippet view article find links to article
targets genus-specific proteins, so orthologous proteins which share sequence homology with each other are recognized as substrates by a particular autophagyAutophagy (8,905 words) [view diff] exact match in snippet view article find links to article
targets genus-specific proteins, so orthologous proteins which share sequence homology with each other are recognized as substrates by a particular autophagyLoop modeling (1,357 words) [view diff] exact match in snippet view article find links to article
(1996.) A structural explanation for the twilight zone of protein sequence homology" Structure 4: 1123–27. Fiser A, Gian Do RK, Sali A. (2000) ModelingPREDITOR (612 words) [view diff] exact match in snippet view article find links to article
angle restraints from searching a database for chemical shift and sequence homology". J. Biomol. NMR. 13 (3): 289–302. doi:10.1023/A:1008392405740. PMID 10212987Intrepicalcin (1,129 words) [view diff] exact match in snippet view article find links to article
Based on the fact that intrepicalcin and imperacalcin have a 70% sequence homology (see Homology), it is predicted that intrepicalcin has a coiled, sphericalPapaya ringspot virus (2,774 words) [view diff] exact match in snippet view article find links to article
different host range, different serological properties, and no nucleotide sequence homology with WMV. WMV also has different cytoplasmic inclusion bodies thatPeptide-mass fingerprint (1,416 words) [view diff] exact match in snippet view article find links to article
MASCOT software uses an algorithm that looks for significant peptide sequence homology to present the most statistically likely protein in the sample, basedHendra virus (4,605 words) [view diff] exact match in snippet view article find links to article
identified in two flying fox species in Australia. It shares 84% sequence homology to other published Hendra virus genomes. This variant has been identifiedMultiple sequence alignment (6,169 words) [view diff] exact match in snippet view article find links to article
Gribskov M (1998). "Combining evidence using p-values: application to sequence homology searches". Bioinformatics. 14 (1): 48–54. doi:10.1093/bioinformatics/14Insert (molecular biology) (1,360 words) [view diff] no match in snippet view article
large volume of information tangible, i.e., the use of ChIP and gene sequence. Homology directed repair (HDR) is a technique repairs breaks or lesions inHLA-A*02 (1,695 words) [view diff] exact match in snippet view article find links to article
As of December 2013, there are 456 alleles identified (mostly by sequence homology) as being A2, of those 27 are nulls, and a large majority have unknownIntegrin-like receptors (1,874 words) [view diff] exact match in snippet view article find links to article
known as αInt1p. This protein maintains structural similarity and sequence homology to the α-subunits of human leukocyte integrins. The αInt1p proteinCarnitine O-octanoyltransferase (1,489 words) [view diff] exact match in snippet view article find links to article
carnitine acetyltransferase (CRAT) and CROT, as these enzymes have 36% sequence homology. A key difference between these enzymes that may explain their selectivitiesHistone (9,575 words) [view diff] exact match in snippet view article find links to article
variant forms in some of the major classes. They share amino acid sequence homology and core structural similarity to a specific class of major histonesGAB2 (3,189 words) [view diff] exact match in snippet view article find links to article
groups later cloned GAB2 by searching DNA database for protein with sequence homology to GAB1. GAB2 is a large multi-site docking protein (LMD) of aboutLmKTT-1a (827 words) [view diff] exact match in snippet view article find links to article
protease inhibitor (SdPI-2). The mature protein of this toxin has 96.6% sequence homology with a toxin named LmKTT-1b (SdPI). The mature protein is establishedBacillus thuringiensis (7,829 words) [view diff] exact match in snippet view article find links to article
insecticidal proteins (Vip; InterPro: IPR022180). Vip proteins do not share sequence homology with Cry proteins, in general do not compete for the same receptorsGroEL (5,438 words) [view diff] exact match in snippet view article find links to article
Waldinger D, Eckerskorn C, Lottspeich F, Cleve H (1988). "Amino-acid sequence homology of a polymorphic cellular protein from human lymphocytes and the chaperoninsButyryl-CoA (2,448 words) [view diff] exact match in snippet view article find links to article
chain acyl-coenzyme A, and isovaleryl-coenzyme A dehydrogenases. Sequence homology of four enzymes of the acyl-CoA dehydrogenase family". The JournalHomology modeling (5,095 words) [view diff] exact match in snippet view article find links to article
(1996.) A structural explanation for the twilight zone of protein sequence homology. Structure 4: 1123–27. Williamson AR (2000). "Creating a structuralTransforming growth factor beta (8,680 words) [view diff] exact match in snippet view article find links to article
downstream signalling pathways. This molecule, termed Hp-TGM, shares no sequence homology to TGF-β and is secreted by H. polygyrus in a biologically activeProtein Wnt-5a (3,402 words) [view diff] exact match in snippet view article find links to article
them to travel systemically. Additionally, due to the high degree of sequence homology between Wnts many are characterized by their downstream actions. Wnt5aAsian giant hornet (10,128 words) [view diff] exact match in snippet view article find links to article
mitochondrial genome of the specimen collected from Blaine, WA shared 99.5% sequence homology to the specimen characterized from South Korea," "How officials inProtein design (7,342 words) [view diff] exact match in snippet view article find links to article
composition. Richardson and coworkers designed a 79-residue protein with no sequence homology to a known protein. In the 1990s, the advent of powerful computersSIGLEC8 (4,511 words) [view diff] exact match in snippet view article find links to article
regarding the function of Siglec-8 on basophils. Due to its high level of sequence homology with CD33 (Siglec-3), Siglec-8 is grouped within the CD33-relatedEvolution of molecular chaperones (1,217 words) [view diff] exact match in snippet view article find links to article
which they have been tested. HSPs are divided into families, based on sequence homology and molecular weight (hsp110, hsp100, hsp90, hsp70, hsp60, hsp40,DNA-directed RNA interference (2,402 words) [view diff] exact match in snippet view article find links to article
problem. Off-target effects: Unintended silencing of genes that share sequence homology with expressed shRNAs can theoretically occur. Careful selection ofType III secretion system (5,859 words) [view diff] exact match in snippet view article find links to article
motility). Some of the proteins participating in T3SS share amino-acid sequence homology to flagellar proteins. Some of the bacteria possessing a T3SS haveSWEET transporters (1,771 words) [view diff] exact match in snippet view article find links to article
was identified. Other potential family members were identified by sequence homology. Chen et al. (2010) reviewed evidence for a new class of sugar transportersActivity-regulated cytoskeleton-associated protein (3,249 words) [view diff] exact match in snippet view article find links to article
in the human, is conserved across vertebrate species and has low sequence homology to spectrin, a cytoskeletal protein involved in forming the actinLacticaseibacillus paracasei (3,268 words) [view diff] exact match in snippet view article find links to article
have been used interchangeably in scientific literature. 16S RNA sequence homology has confirmed the relatedness between these species but core genomeAutoimmune encephalitis (3,413 words) [view diff] exact match in snippet view article find links to article
are both G-protein-coupled receptors that share an 85% amino acid sequence homology. Both receptors are involved in modulating synaptic functions includingWest Caucasian bat lyssavirus (1,897 words) [view diff] exact match in snippet view article find links to article
lyssavirus genus can be divided into four phylogroups based upon DNA sequence homology. Phylogroup I includes viruses, such as Rabies virus, Duvenhage virusGlycodelin (2,981 words) [view diff] exact match in snippet view article find links to article
Närvänen A, Palomäki P, Julkunen M, Bohn H (Jun 1987). "Amino acid sequence homology between human placental protein 14 and beta-lactoglobulins from variousMetabolic network modelling (5,355 words) [view diff] exact match in snippet view article find links to article
and bioinformatics resources have been developed for refinement of sequence homology-based assignments of protein functions: InParanoid: Identifies eukaryoticPlastid terminal oxidase (1,860 words) [view diff] exact match in snippet view article find links to article
and is bound to the thylakoid membrane facing the stroma. Based on sequence homology, the enzyme is predicted to contain four alpha helix domains thatOrientia tsutsugamushi (8,133 words) [view diff] exact match in snippet view article find links to article
analysis of the Sta58 major antigen gene of Rickettsia tsutsugamushi: sequence homology and antigenic comparison of Sta58 to the 60-kilodalton family of stressGap junction (10,816 words) [view diff] exact match in snippet view article find links to article
comprise proteins from the innexin family. Innexins have no significant sequence homology with connexins. Though differing in sequence to connexins, innexinsShort interspersed nuclear element (5,251 words) [view diff] exact match in snippet view article find links to article
horizontal transfer through a viral vector. SINEs are known to share sequence homology with LINES which gives a basis by which the LINE machinery can reverseRAPGEF3 (3,461 words) [view diff] exact match in snippet view article find links to article
Rooij and colleagues performed a database search for proteins with sequence homology to both GEFs for Ras and Rap1 and to cAMP-binding sites, which ledRosetta@home (8,568 words) [view diff] exact match in snippet view article find links to article
information from structural homology and must rely on information from sequence homology and modeling physical interactions within the protein. Rosetta@homeHHV Infected Cell Polypeptide 0 (2,688 words) [view diff] exact match in snippet view article find links to article
IE110 (n/a) HHV-2 Herpes simplex virus-2 (HSV-2) has 61.5% amino acid sequence homology to HSV-1 ICP0. HHV-3 Varicella zoster virus (VZV) ORF-61 Shows homology1-Aminocyclopropane-1-carboxylate synthase (2,686 words) [view diff] exact match in snippet view article find links to article
crystallography. Conservation of the residues in ACS's catalytic domain and sequence homology suggest that ACS catalyzes the synthesis of ACC in a similar fashionVLDL receptor (4,708 words) [view diff] exact match in snippet view article find links to article
within the LDL receptor family. In particular, there is 50% overall sequence homology between VLDLR and ApoER2, another lipoprotein receptor of this familyJack D. Keene (1,898 words) [view diff] exact match in snippet view article find links to article
Schubert, M.; Lazzarini, R. A.; Rosenberg, M. (1 July 1978). "Nucleotide sequence homology at the 3' termini of RNA from vesicular stomatitis virus and its defectiveDNA shuffling (2,913 words) [view diff] exact match in snippet view article find links to article
disadvantages of StEP include that it is time consuming and requires sequence homology. SCOPE (protein engineering) Glick BR (2017). Molecular biotechnology :Eocyte hypothesis (4,670 words) [view diff] exact match in snippet view article find links to article
protein is a molecular chaperone. This creates an issue with the sequence homology that has been seen between 70 kilodalton heat shock proteins in eukaryotesPEPD (3,545 words) [view diff] exact match in snippet view article find links to article
Co atoms are replaced with Zn, which hinders enzymatic activity. Sequence homology between human and Pfprol yield only 25% identity and 43% similarityIQGAP1 (3,922 words) [view diff] exact match in snippet view article find links to article
name stems from the fact that its RasGAP-related domain (GRD) has sequence homology to the Sar1 GTPase. It was hypothesized that IQGAP1 would act as aHuman herpesvirus 6 (8,021 words) [view diff] exact match in snippet view article find links to article
etiologic agent for this condition. Within these two viruses is a sequence homology of 95%. In 2012, HHV-6A and HHV-6B were officially recognized as distinctCASS4 (3,332 words) [view diff] exact match in snippet view article find links to article
predominant species, and at 786 amino acids is the longest one. Amino acid sequence homology of this isoform of human CASS4 with other family members is 26% overallKedarcidin (2,705 words) [view diff] exact match in snippet view article find links to article
benzoate substructures, respectively. Five genes, KedN1–N5, bear high sequence homology with the enzymes responsible for naphthonate synthesis inABC transporter (14,398 words) [view diff] exact match in snippet view article find links to article
It is a close bacterial homolog of P-glycoprotein (Pgp) by protein sequence homology and has overlapping substrate specificities with the MDR-ABC transporterGT198 (2,345 words) [view diff] exact match in snippet view article find links to article
sunitinib, trifluridine, and aminolevulinic acid. GT198 has protein sequence homology with DNA topoisomerase, so that DNA topoisomerase inhibitors are alsoTrypanosoma brucei (12,253 words) [view diff] exact match in snippet view article find links to article
variant surface glycoprotein. However, it has little similarity (low sequence homology) with the VSG gene (<25%). SRA is an expression site associated geneYop1p (1,460 words) [view diff] exact match in snippet view article find links to article
interaction patterns. Although reticulons do not share any primary sequence homology with DP1/Yop1p proteins, both families have a conserved domain ofKcsA potassium channel (3,461 words) [view diff] exact match in snippet view article find links to article
with K+ ions passing through the channel The discovery of strong sequence homology between KcsA and other channels in the Kv family, including the ShakerSerpin (14,251 words) [view diff] exact match in snippet view article find links to article
PMID 17889653. Hejgaard J, Rasmussen SK, Brandt A, SvendsenI (1985). "Sequence homology between barley endosperm protein Z and protease inhibitors of theSoluble NSF attachment protein (3,344 words) [view diff] exact match in snippet view article find links to article
found in brain tissues. α-SNAP and β-SNAP share approximately 83% sequence homology and are encoded by NAPA and NAPB on chromosomes 19 and 18, respectivelySNP annotation (4,230 words) [view diff] exact match in snippet view article find links to article
whether an amino acid substitution affects protein function. SIFT uses sequence homology to predict whether an amino acid substitution will affect proteinSex-chromosome dosage compensation (7,645 words) [view diff] exact match in snippet view article find links to article
birds evolved separately from those of mammals and share very little sequence homology with the XY chromosomes. As such, scientists refer to bird sex chromosomesEvidence of common descent (27,660 words) [view diff] exact match in snippet view article find links to article
into evolutionary biology. Both chicken and turkeys have identical sequence homology (amino acid for amino acid), as do pigs, cows and sheep. Both humansAnne Schaefer (scientist) (2,946 words) [view diff] exact match in snippet view article
therapeutic strategy involves administering miR-128, an agent with 90% sequence homology, or an agent capable of increasing the expression or activity of miR-128AtSCE1 (1,718 words) [view diff] exact match in snippet view article find links to article
characteristics with ubiquitin, despite the fact that they only have 8-15% sequence homology. Both fold into a similarly shaped globular structure with an exposedΑr35 RNA (1,756 words) [view diff] exact match in snippet view article find links to article
assigned to any functional category on the basis of the amino acid sequence homology. Thus, these αr35 members are putative cis-encoded antisense sRNAsAldehyde tag (2,916 words) [view diff] exact match in snippet view article find links to article
acids. A set of organisms from all domains of life was chosen and the sequence homology of the sulfatase motif was determined. The sequence used is the bestBottromycin (3,272 words) [view diff] exact match in snippet view article find links to article
and the precursor peptide is termed BstA. BstA shares high sequence homology with BtmD in the follower peptide region. Unlike other ribosomal peptideBacterial microcompartment (8,058 words) [view diff] exact match in snippet view article find links to article
the shell proteins have not been found to have any structural or sequence homology to capsid proteins. Instead, structural and sequence comparisons suggestFunctional cloning (3,006 words) [view diff] exact match in snippet view article find links to article
experimentally, it can also lead to missed genes of interest due to differing sequence homology in genes of related function. Gibson assembly is a quick cloning methodGibbon ape leukemia virus (3,801 words) [view diff] exact match in snippet view article find links to article
New Guinea. Immunological analysis highlights that MbRV shares 93% sequence homology with GaLV-SEATO which is significantly higher than McERV and MDEVCasein kinase 1 isoform epsilon (5,389 words) [view diff] exact match in snippet view article find links to article
in the phosphorylation of PER. However its gene sequence shows no sequence homology. In addition, casein kinase 1 epsilon does not completely rescue circadianGene Disease Database (4,122 words) [view diff] exact match in snippet view article find links to article
amino acid substitution is likely to affect protein function based on sequence homology and the physic-chemical similarity between the alternate amino acidsWildlife forensic science (4,174 words) [view diff] exact match in snippet view article find links to article
with reference DNA sequences of different species. The similarity or sequence homology between the unknown and reference sequences facilitates to ascertainHelicoverpa zea nudivirus 2 (4,466 words) [view diff] exact match in snippet view article find links to article
in the HzNV-1 genome. None of which have been determined to share sequence homology with any genes of known function. The C-terminal region of Hz2V008Off-target genome editing (6,822 words) [view diff] exact match in snippet view article find links to article
the HIV virus to enter the cell. As a result of the high degree of sequence homology between C-C chemokine receptors this ZFN also cleaves CCR2, leadingCytotoxin K (1,686 words) [view diff] exact match in snippet view article find links to article
research revealed two distinct cytK gene variants with substantial sequence homology; these were designated cytK-1 and cytK-2 in accordance with theirRBM10 (5,530 words) [view diff] exact match in snippet view article find links to article
conserved among mammals. Human RBM10 isoform 1 shares 96% and 97% sequence homology with those of mice and rats, respectively, indicating that the molecularSecreted frizzled-related protein 1 (6,317 words) [view diff] exact match in snippet view article find links to article
length and contains a cysteine-rich domain (CRD) that shares 30-50% sequence homology with the CRD of Frizzled (Fz) receptors. SFRPs are able to bind WntMagnesium transporter (12,021 words) [view diff] exact match in snippet view article find links to article
was suggested by MacDiarmid and Gardner (1998), on the strength on sequence homology, and more recently by Lee and Gardner (2006), on the strength of mutagenesisThermal shift assay (5,530 words) [view diff] exact match in snippet view article find links to article
proteomics approaches are often obscure if they have low amino acid sequence homology with proteins of known function. In many cases some useful information